Mettl21a (NM_025964) Mouse Recombinant Protein
CAT#: TP502463
Purified recombinant protein of Mouse methyltransferase like 21A (Mettl21a), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR202463 protein sequence
Red=Cloning site Green=Tags(s) MALVPYEESAAIGLQKFHKPLATFSFANHTIQIRQDWRQLGVAAVVWDAAVVLSMYLEMGAVELRGCSAV ELGAGTGLVGIVAALPGAQVTITDRKVALEFLKSNVEANLPPHIQPKAVVKELTWGQNLESFSPGEFDLI LGADVIYLEDTFTDLLQTLGHLCSNNSVILLACRIRYERDSNFLTMLERQFTVSKVHYDPEKDVHIYKAQ KRNQREDL myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 24.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_080240 |
| Locus ID | 67099 |
| UniProt ID | Q9CQL0 |
| Refseq Size | 2666 |
| Cytogenetics | 1 C2 |
| Refseq ORF | 654 |
| Synonyms | 2310038H17Rik; AI464204; Fam119a |
| Summary | Protein-lysine methyltransferase that selectively trimethylates residues in heat shock protein 70 (HSP70) family members. Contributes to the in vivo trimethylation of Lys residues in HSPA1 and HSPA8. In vitro methylates 'Lys-561' in HSPA1, 'Lys-564' in HSPA2, 'Lys-585' in HSPA5, 'Lys-563' in HSPA6 and 'Lys-561' in HSPA8 (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
其它Mettl21a产品
