Psmc3ip (NM_008949) Mouse Recombinant Protein
CAT#: TP502419
Purified recombinant protein of Mouse proteasome (prosome, macropain) 26S subunit, ATPase 3, interacting protein (Psmc3ip), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
CNY 1050.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR202419 protein sequence
Red=Cloning site Green=Tags(s) MSKSRAEAAAGAPGIILRYLQEQNRPYSAQDVFGNLQKEHGLGKAAVVKALDQLAQEGKIKEKTYGKQKI YFADQNQFDTVSDADLHGLDASIVALTAKVQSLQQSCRHMEAELKELTSALTTPEMQKEIQELKKECAQY TERLKNIKAATNHVTPEEKEKVYRDRQKYCKEWRKRKRMTTELCDAILEGYPKSKKQFFEEVGIETDEDH NVLLPDP myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 24.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_032975 |
| Locus ID | 19183 |
| UniProt ID | O35047 |
| Refseq Size | 984 |
| Cytogenetics | 11 D |
| Refseq ORF | 651 |
| Synonyms | C79099; GT198; HOP2; Tbpip |
| Summary | Plays an important role in meiotic recombination. Stimulates DMC1-mediated strand exchange required for pairing homologous chromosomes during meiosis. The complex PSMC3IP/MND1 binds DNA, stimulates the recombinase activity of DMC1 as well as DMC1 D-loop formation from double-strand DNA. This complex stabilizes presynaptic RAD51 and DMC1 filaments formed on single strand DNA to capture double-strand DNA. This complex stimulates both synaptic and presynaptic critical steps in RAD51 and DMC1-promoted homologous pairing. May inhibit HIV-1 viral protein TAT activity and modulate the activity of proteasomes through association with PSMC3.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
其它Psmc3ip产品
