Nola1 (BC021873) Mouse Recombinant Protein
CAT#: TP502402
Purified recombinant protein of Mouse nucleolar protein family A, member 1 (H/ACA small nucleolar RNPs) (cDNA clone MGC:28064 IMAGE:3709271),, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR202402 protein sequence
Red=Cloning site Green=Tags(s) MSFRGGGRGGFNRGGGGGGFNRGGGGGSFRGGGGGGSFRGGGRGGFGRGGGRGGFNKFQDQGPPERVVLL GEFMHPCEDDIVCKCTTEENKVPYFNAPVYLENKEQVGKVDEIFGQLRDFYFSVKLSENMKASSFKKLQK FYIDPYKLLPLQRFLPRPPGEKGPPRGGGGGGRGGRGGGRGGGGRGGGRGGGFRGGRGGGGGFRGGRGGG GFRGRGH myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 22.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| Locus ID | 68147 |
| UniProt ID | Q9CY66 |
| Refseq Size | 1145 |
| Cytogenetics | 3 G3 |
| Refseq ORF | 651 |
| Synonyms | GAR1 |
| Summary | Required for ribosome biogenesis and telomere maintenance. Part of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP) complex, which catalyzes pseudouridylation of rRNA. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Each rRNA can contain up to 100 pseudouridine ("psi") residues, which may serve to stabilize the conformation of rRNAs. May also be required for correct processing or intranuclear trafficking of TERC, the RNA component of the telomerase reverse transcriptase (TERT) holoenzyme (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
