Cdc42ep2 (NM_026772) Mouse Recombinant Protein

CAT#: TP502347

Purified recombinant protein of Mouse CDC42 effector protein (Rho GTPase binding) 2 (Cdc42ep2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR202347 protein sequence
Red=Cloning site Green=Tags(s)

MSTKVPIYLKRGSRKGKKEKLRDLLSSDMISPPLGDFRHTIHIGSGGGDDMFGDISFLQGKFHLLPGTAV
EEAEEDGSFDLPFQFTRTTTVCGRELPDGLSPLLKNAISLPVIGGPQALTLPTAQAPPKPPRLHLESPQP
SPQPSPQGAGNVDVWRIPEAGSPHNGMSPEPEAEEPFLSHASSLLSLHVDLGPSILDDVLQIMDHDLGRV
QIPT

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 23 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_081048
Locus ID 104252
UniProt ID Q8JZX9
Refseq Size 1491
Cytogenetics 19 4.34 cM
Refseq ORF 642
Synonyms 1110008C05Rik; Borg1; Cep2; D19Bwg1013e
Summary Probably involved in the organization of the actin cytoskeleton. May act downstream of CDC42 to induce actin filament assembly leading to cell shape changes. Induces pseudopodia formation in fibroblasts in a CDC42-dependent manner (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...