Gemin8 (NM_146238) Mouse Recombinant Protein
CAT#: TP502283
Purified recombinant protein of Mouse gem nuclear organelle associated protein 8 (Gemin8), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
货期*
4周
规格
Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR202283 protein sequence
Red=Cloning site Green=Tags(s) MLWMQGHQNAYRKFRDSYFTSPWLFPHGALPWNSPAYEAGHPWDSQGQHMAQQESPYRVSHPKSPGQPLH NSSRTQASTRGNEARCEEEELESDSDDEVECDLSNMEITEELRQYFAQTERHREERRRQQQLDAERLNYY VNADHGLYFNHRRSLEPPSEKPWERRQAEMKRLYGNSAPKILAMETAVQLSFDKHCDRKQPKYWPVIPLK F myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 25.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_666350 |
Locus ID | 237221 |
UniProt ID | Q8BHE1 |
Refseq Size | 1836 |
Cytogenetics | X F5 |
Refseq ORF | 633 |
Synonyms | B130034M20Rik; B930082C09Rik; BC023488; gemin-8 |
Summary | The SMN complex plays a catalyst role in the assembly of small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Thereby, plays an important role in the splicing of cellular pre-mRNAs. Most spliceosomal snRNPs contain a common set of Sm proteins SNRPB, SNRPD1, SNRPD2, SNRPD3, SNRPE, SNRPF and SNRPG that assemble in a heptameric protein ring on the Sm site of the small nuclear RNA to form the core snRNP. In the cytosol, the Sm proteins SNRPD1, SNRPD2, SNRPE, SNRPF and SNRPG are trapped in an inactive 6S pICln-Sm complex by the chaperone CLNS1A that controls the assembly of the core snRNP. Dissociation by the SMN complex of CLNS1A from the trapped Sm proteins and their transfer to an SMN-Sm complex triggers the assembly of core snRNPs and their transport to the nucleus (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
You may also need
Customer
Reviews
Loading...