Ict1 (BC028523) Mouse Recombinant Protein
CAT#: TP502185
Purified recombinant protein of Mouse immature colon carcinoma transcript 1 (cDNA clone MGC:41300 IMAGE:2938122), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images

CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR202185 protein sequence
Red=Cloning site Green=Tags(s) MATAWGLRWGLSRTGTLLLAPPARCARRALHRQVDGTTFQSIYSLDKLYPESKGADTAWKVPEHAKQASS YIPLDRLSISYCRSSGPGGQNVNKVNSKAEVRFHLASADWIEEPVRQKIALTHKNKINKAGELVLTSESS RYQFRNLAECLQKIRDMIAEASQVPKEPSKEDARLQRLRIEKMNRERLRQKRLNSALKTSRRMTMD myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 23.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
Locus ID | 68572 |
UniProt ID | Q8R035 |
Refseq Size | 879 |
Cytogenetics | 11 E2 |
Refseq ORF | 618 |
Synonyms | 1110001A02Rik; 1110002E03Rik; MRP-L58 |
Summary | Essential peptidyl-tRNA hydrolase component of the mitochondrial large ribosomal subunit (PubMed:20869366). Acts as a codon-independent translation release factor that has lost all stop codon specificity and directs the termination of translation in mitochondrion, possibly in case of abortive elongation. May be involved in the hydrolysis of peptidyl-tRNAs that have been prematurely terminated and thus in the recycling of stalled mitochondrial ribosomes (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |