Rbpms2 (NM_028030) Mouse Recombinant Protein

CAT#: TP502168

Purified recombinant protein of Mouse RNA binding protein with multiple splicing 2 (Rbpms2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR202168 protein sequence
Red=Cloning site Green=Tags(s)

MSNLKPDVEHCTGAGTGSPLEEEVRTLFVSGLPVDIKPRELYLLFRPFKGYEGSLIKLTSRQPVGFVIFD
SRAGAEAAKNALNGIRFDPENPQTLRLEFAKANTKMAKSKLIATPNPTSVHPALGAHLIARDPYDLMGTA
LIPASPEAWAPYPLYTTELTPAISHTTFTYPAATAAAAAAATLHAQVRWYPSSDTTQQGWKYRQFC

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 22.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_082306
Locus ID 71973
UniProt ID Q8VC52
Refseq Size 1956
Cytogenetics 9 C
Refseq ORF 618
Synonyms 2400008B06Rik; AI316523
Summary Contributes to the regulation of smooth muscle cell differentiation and proliferation in the gastrointestinal system. Binds NOG mRNA. Mediates an increase of NOG mRNA levels, and thereby contributes to the negative regulation of the BMP signaling pathway. This promotes reversible dedifferentiation of smooth muscle cells and promotes smooth muscle cell proliferation.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...