Spata24 (NM_029485) Mouse Recombinant Protein
CAT#: TP502158
Purified recombinant protein of Mouse spermatogenesis associated 24 (Spata24), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR202158 representing NM_029485
Red=Cloning site Green=Tags(s) MATPLGWSQGGSGSVCLAFDQLRDVIESQEELIHQLRNVMVLQDENFVSKEEFHEIEKKLVEEKAAHAKT KALLAKEEEKLQFALGEVEVLSKQLEKEKMAFEKALSSVKSRVLQESSKKDQLITKCNEIESHIIKQEDI LNGKENEIKELQQVISQQKQNFRNHISDFRIQKQQETYMAQVLDQKRKKATGMRRARSRQCSREK myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 23.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_083761 |
| Locus ID | 71242 |
| UniProt ID | Q6P926 |
| Refseq Size | 721 |
| Cytogenetics | 18 B2 |
| Refseq ORF | 615 |
| Synonyms | 2700012K08Rik; 4930583E11Rik; 5133400G04Rik; AU016220; TIPT; TIPT2 |
| Summary | Binds DNA with high affinity but does not bind to TATA boxes. Synergises with GMNN and TBP in activation of TATA box-containing promoters and with GMNN and TBPL1 in activation of the NF1 TATA-less promoter. May play a role in cytoplasm movement and removal during spermiogenesis.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
其它Spata24产品
