Ube2t (NM_026024) Mouse Recombinant Protein

CAT#: TP502115

Purified recombinant protein of Mouse ubiquitin-conjugating enzyme E2T (Ube2t), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR202115 protein sequence
Red=Cloning site Green=Tags(s)

MQRASRLKKELHMLAIEPPPGITCWQEKDQVADLRAQILGGANTPYEKGVFTLEVIIPERYPFEPPQVRF
LTPIYHPNIDSSGRICLDILKLPPKGAWRPSLNIATVLTSIQLLMAEPNPDDPLMADISSEFKYNKIAFL
KKAKQWTEAHARQKQKADEEELGTSSEVGDSEESHSTQKRKARPLGGMEKKFSPDVQRVYPGPS

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 23 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_080300
Locus ID 67196
UniProt ID Q9CQ37
Refseq Size 1134
Cytogenetics 1 E4
Refseq ORF 612
Synonyms 2700084L22Rik; C80607
Summary Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. Catalyzes monoubiquitination. Involved in mitomycin-C (MMC)-induced DNA repair: acts as a specific E2 ubiquitin-conjugating enzyme for the Fanconi anemia complex by associating with E3 ubiquitin-protein ligase FANCL and catalyzing monoubiquitination of FANCD2, a key step in the DNA damage pathway. Also mediates monoubiquitination of FANCL and FANCI. May contribute to ubiquitination and degradation of BRCA1. In vitro able to promote polyubiquitination using all 7 ubiquitin Lys residues, but may prefer 'Lys-11'-, 'Lys-27'-, 'Lys-48'- and 'Lys-63'-linked polyubiquitination.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...