Ccdc28b (NM_025455) Mouse Recombinant Protein
CAT#: TP502023
Purified recombinant protein of Mouse coiled coil domain containing 28B (Ccdc28b), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images

CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR202023 protein sequence
Red=Cloning site Green=Tags(s) MEDKKKKRSPKPCLTQQAQAPGTLRRVPVPTSHSGSLALGLPHLPSPKQRAKFKRAGKEKCRPVLAGGGG GSAGTPLQHSFLTEVTDVYEMEGGLLNLLNDFHSGRLQAFGKECSFEQLEHVREMQEKLARLHFSLDVCG EEEDEEEEEDGVTEGLPEEQKKTMADRNLDQLLSNLEDLSNSIQKLHLAENAEPEDQPAA myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 22.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_079731 |
Locus ID | 66264 |
UniProt ID | Q8CEG5 |
Refseq Size | 856 |
Cytogenetics | 4 D2.2 |
Refseq ORF | 600 |
Synonyms | 1110002E08Rik; 1810010N17Rik |
Summary | Involved in ciliogenesis. Regulates cilia length through its interaction with MAPKAP1/SIN1 but independently of mTORC2 complex. Modulates mTORC2 complex assembly and function, possibly enhances AKT1 phosphorylation. Does not seem to modulate assembly and function of mTORC1 complex.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
其它Ccdc28b产品