Ccdc28b (NM_025455) Mouse Recombinant Protein
CAT#: TP502023
Purified recombinant protein of Mouse coiled coil domain containing 28B (Ccdc28b), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 2900.00
Product images
                    
                CNY 600.00
Specifications
| Product Data | |
| Species | Mouse | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >MR202023 protein sequence 
Red=Cloning site Green=Tags(s) MEDKKKKRSPKPCLTQQAQAPGTLRRVPVPTSHSGSLALGLPHLPSPKQRAKFKRAGKEKCRPVLAGGGG GSAGTPLQHSFLTEVTDVYEMEGGLLNLLNDFHSGRLQAFGKECSFEQLEHVREMQEKLARLHFSLDVCG EEEDEEEEEDGVTEGLPEEQKKTMADRNLDQLLSNLEDLSNSIQKLHLAENAEPEDQPAA TRTRPLEQKLISEEDLAANDILDYKDDDDKV  | 
        
| Tag | C-MYC/DDK | 
| Predicted MW | 22.1 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C after receiving vials. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_079731 | 
| Locus ID | 66264 | 
| UniProt ID | Q8CEG5 | 
| Refseq Size | 856 | 
| Cytogenetics | 4 D2.2 | 
| Refseq ORF | 600 | 
| Synonyms | 1110002E08Rik; 1810010N17Rik | 
| Summary | Involved in ciliogenesis. Regulates cilia length through its interaction with MAPKAP1/SIN1 but independently of mTORC2 complex. Modulates mTORC2 complex assembly and function, possibly enhances AKT1 phosphorylation. Does not seem to modulate assembly and function of mTORC1 complex.[UniProtKB/Swiss-Prot Function] | 
Documents
| FAQs | 
| SDS | 
其它Ccdc28b产品
