Alad (BC018236) Mouse Recombinant Protein
CAT#: TP501832
Purified recombinant protein of Mouse aminolevulinate, delta-, dehydratase (cDNA clone MGC:18970 IMAGE:3992605), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images

CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR201832 protein sequence
Red=Cloning site Green=Tags(s) MHHQSVLHSGYFHPLLRSWQTAASTVSASNLIYPIFVTDVPDDVQPIASLPGVARYGVNQLEEMLRPLVE AGLRCVLIFGVPSRVPKDEQGSAADSEDSPTIEAVRLLRKTFPSLLVACDVCLCPYTSHGHCGLLSENGA FLAEESRQRLAEVALAYAKAGCQVVAPSDMMDGRVEAIKAALLKHGLGNRV myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 20.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
Locus ID | 17025 |
UniProt ID | P10518 |
Refseq Size | 1785 |
Cytogenetics | 4 33.17 cM |
Refseq ORF | 573 |
Synonyms | ALADH; Lv |
Summary | Catalyzes an early step in the biosynthesis of tetrapyrroles. Binds two molecules of 5-aminolevulinate per subunit, each at a distinct site, and catalyzes their condensation to form porphobilinogen (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |