Bloc1s5 (NM_139063) Mouse Recombinant Protein
CAT#: TP501726
Purified recombinant protein of Mouse biogenesis of lysosomal organelles complex-1, subunit 5, muted (Bloc1s5), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images

CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR201726 protein sequence
Red=Cloning site Green=Tags(s) MSGGGTETPVACDAAQGGKKRDSLGTPGAAHLIIKDLGEIHSRLLDHRPVTQGEIRYFVKEFEEKRGLRE LRVLKNLENTIQETNECLLPKCRETMECGLGETLQRLQAANDSICRLQQREQERKKVINDYLTASEKRRL VQWEEFVSGQPQRRAEVDEEHRRAVERLREQYAAMEKDLAKFSTF myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 21.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_620702 |
Locus ID | 17828 |
UniProt ID | Q8R015 |
Refseq Size | 1791 |
Cytogenetics | 13 18.35 cM |
Refseq ORF | 555 |
Synonyms | 1810074A19Rik; mu; Muted |
Summary | Component of the BLOC-1 complex, a complex that is required for normal biogenesis of lysosome-related organelles (LRO), such as platelet dense granules and melanosomes. In concert with the AP-3 complex, the BLOC-1 complex is required to target membrane protein cargos into vesicles assembled at cell bodies for delivery into neurites and nerve terminals. The BLOC-1 complex, in association with SNARE proteins, is also proposed to be involved in neurite extension. Plays a role in intracellular vesicle trafficking.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
其它Bloc1s5产品