Ssu72 (BC016544) Mouse Recombinant Protein
CAT#: TP501644
Purified recombinant protein of Mouse Ssu72 RNA polymerase II CTD phosphatase homolog (yeast) (cDNA clone MGC:27889 IMAGE:3497878), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images

CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR201644 protein sequence
Red=Cloning site Green=Tags(s) MPSSPLRVAVVCSSNQNRSMEAHNILSKRGFSVRSFGTGTHVKLPGPAPDKPNVYDFKTTYDQMYNDLLR KDKELYTQNGILHMLDRNKRIKPRPERFQNCTDLFDLILTCEERVYDQVVEDLNSREQETCQPVHVVNVD IQDNHEEATLGAFLICELCQCVSLSSWVLLGLLIATYKNKIK myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 20.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
Locus ID | 68991 |
UniProt ID | Q9CY97 |
Refseq Size | 884 |
Cytogenetics | 4 E2 |
Refseq ORF | 546 |
Synonyms | 1190002E22Rik; 1500011L16Rik; 2610101M12Rik |
Summary | Protein phosphatase that catalyzes the dephosphorylation of the C-terminal domain of RNA polymerase II. Plays a role in RNA processing and termination. Plays a role in pre-mRNA polyadenylation via its interaction with SYMPK.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |