Ccdc115 (NM_027159) Mouse Recombinant Protein
CAT#: TP501615
Purified recombinant protein of Mouse coiled-coil domain containing 115 (Ccdc115), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images

CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR201615 protein sequence
Red=Cloning site Green=Tags(s) MAVQALREELDSKCLQLLSDLEELEAKRAALNARVEEGWLSLAKARYAMGAKSVGPLQYASRMEPQVCVR ASEAQDGPQTFRVIKADAQTPEEVGPSEASLRRRKGPTKTKELGSAVVPQDPLNWFGILVPHSLRQAQAS FRDGLQLAADIASLQTRINWGQSQLRGLQKKLKELDPGPA myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 19.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_081435 |
Locus ID | 69668 |
UniProt ID | Q8VE99 |
Refseq Size | 1721 |
Cytogenetics | 1 B |
Refseq ORF | 540 |
Synonyms | 2310061I09Rik; Ccp1 |
Summary | Accessory component of the proton-transporting vacuolar (V)-ATPase protein pump involved in intracellular iron homeostasis. In aerobic conditions, required for intracellular iron homeostasis, thus triggering the activity of Fe(2+) prolyl hydroxylase (PHD) enzymes, and leading to HIF1A hydroxylation and subsequent proteasomal degradation. Necessary for endolysosomal acidification and lysosomal degradation (By similarity). May be involved in Golgi homeostasis (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
其它Ccdc115产品