Vps25 (NM_026776) Mouse Recombinant Protein

CAT#: TP501538

Purified recombinant protein of Mouse vacuolar protein sorting 25 (Vps25), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (2)
VPS25 Antibody - middle region
    • 50 ug

CNY 4628.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR201538 protein sequence
Red=Cloning site Green=Tags(s)

MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLP
VESIQIVLEELRKKGNLEWLDKNKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTSGEDTEDEE
FHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 20.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_081052
Locus ID 28084
UniProt ID Q9CQ80
Refseq Size 1119
Cytogenetics 11 64.48 cM
Refseq ORF 528
Synonyms 1110020N13Rik; AW107467; D11Wsu68e
Summary Component of the ESCRT-II complex (endosomal sorting complex required for transport II), which is required for multivesicular body (MVB) formation and sorting of endosomal cargo proteins into MVBs. The MVB pathway mediates delivery of transmembrane proteins into the lumen of the lysosome for degradation. The ESCRT-II complex is probably involved in the recruitment of the ESCRT-III complex. The ESCRT-II complex may also play a role in transcription regulation, possibly via its interaction with ELL (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...