Flt3l (BC019801) Mouse Recombinant Protein
CAT#: TP501410
Purified recombinant protein of Mouse FMS-like tyrosine kinase 3 ligand (cDNA clone MGC:30232 IMAGE:5132319), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
View other "Flt3l" proteins (1)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images

CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR201410 protein sequence
Red=Cloning site Green=Tags(s) MTVLAPAWSPNSSLLLLLLLLSPCLRGTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKH CKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLL ALKPCIGKACQNFSRCLETPPPCCPQGVP myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 19 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
Locus ID | 14256 |
UniProt ID | P49772 |
Refseq Size | 990 |
Cytogenetics | 7 29.14 cM |
Refseq ORF | 507 |
Synonyms | Flt3lg; Ly72L |
Summary | Stimulates the proliferation of early hematopoietic cells by activating FLT3. Synergizes well with a number of other colony stimulating factors and interleukins.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
TP723956 | Human FLT3 Ligand Protein, mFc-His Tag |
CNY 5876.00 |