Avp (NM_009732) Mouse Recombinant Protein
CAT#: TP501383
Purified recombinant protein of Mouse arginine vasopressin (Avp), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 2900.00
货期*
                        4周
                    规格
                        Product images
                    
                
                         推荐一起购买 (1)
                    
                    
                                        DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
                                    
                                CNY 600.00
Specifications
| Product Data | |
| Species | Mouse | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >MR201383 protein sequence 
Red=Cloning site Green=Tags(s) MLARMLNTTLSACFLSLLAFSSACYFQNCPRGGKRAISDMELRQCLPCGPGGKGRCFGPSICCADELGCF VGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAAVGICCSDESCVAEPECHDGFFRLTRAREPSNATQLD GPARALLLRLVQLAGTRESVDSAKPRVY myc-FLAG tag  | 
        
| Tag | C-MYC/DDK | 
| Predicted MW | 17.9 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C after receiving vials. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_033862 | 
| Locus ID | 11998 | 
| UniProt ID | P35455 | 
| Refseq Size | 507 | 
| Cytogenetics | 2 63.24 cM | 
| Refseq ORF | 504 | 
| Synonyms | Vp; Vsp | 
| Summary | This gene encodes a member of the vasopressin/oxytocin family and preproprotein that is proteolytically processed to generate multiple protein products. These products include the neuropeptide hormone arginine vasopressin, and two other peptides, neurophysin 2 and copeptin. Arginine vasopressin binds to vasopressin receptors and functions as a vasopressor, to constrict blood vessels and increase blood pressure, and as an antidiuretic, to reduce the production of urine. Neurophysin 2 functions as a carrier protein in the transport of arginine vasopressin. This gene is present in a gene cluster with the related gene oxytocin on chromosome 2. [provided by RefSeq, Aug 2015] | 
Documents
| FAQs | 
| SDS | 
            You may also need
        
        
    
                         Customer
                                Reviews 
                    
                    
                                Loading...
                            
                        