Myl2 (NM_010861) Mouse Recombinant Protein
CAT#: TP501346
Purified recombinant protein of Mouse myosin, light polypeptide 2, regulatory, cardiac, slow (Myl2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
货期*
4周
规格
推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR201346 protein sequence
Red=Cloning site Green=Tags(s) MAPKKAKKRIEGGSSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMI KEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGSLKADYVREMLTTQAGRFSKEEIDQMFA AFPPDVTGNLDYKNLVHIITHGEEKD myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 18.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_034991 |
| Locus ID | 17906 |
| UniProt ID | P51667 |
| Refseq Size | 633 |
| Cytogenetics | 5 F |
| Refseq ORF | 498 |
| Synonyms | MLC-2; MLC-2s/v; MLC-2v; Mlc2v; Mylpc |
| Summary | Contractile protein that plays a role in heart development and function (PubMed:10409661). Following phosphorylation, plays a role in cross-bridge cycling kinetics and cardiac muscle contraction by increasing myosin lever arm stiffness and promoting myosin head diffusion; as a consequence of the increase in maximum contraction force and calcium sensitivity of contraction force. These events altogether slow down myosin kinetics and prolong duty cycle resulting in accumulated myosins being cooperatively recruited to actin binding sites to sustain thin filament activation as a means to fine-tune myofilament calcium sensitivity to force (By similarity) (PubMed:22426213, PubMed:16908724, PubMed:10409661). During cardiogenesis plays an early role in cardiac contractility by promoting cardiac myofibril assembly (PubMed:9422794).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
You may also need
Customer
Reviews
Loading...
