Litaf (NM_019980) Mouse Recombinant Protein
CAT#: TP501259
Purified recombinant protein of Mouse LPS-induced TN factor (Litaf), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
货期*
4周
规格
Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR201259 protein sequence
Red=Cloning site Green=Tags(s) MSAPGPYQAAAGPSVVPTAPPTYEETVGVNSYYPTPPAPMPGPATGLITGPDGKGMNPPSYYTQPVPVPN ANAIAVQTVYVQQPVSFYDRPVQMCCPSCSKMIVTQLSYNAGALTWLSCGSLCLLGCVAGCCFIPFCVDA LQDVDHYCPNCKALLGTYKRL myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 16.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_064364 |
Locus ID | 56722 |
UniProt ID | Q9JLJ0 |
Refseq Size | 2240 |
Cytogenetics | 16 A1 |
Refseq ORF | 483 |
Synonyms | 3222402J11Rik; C85531; N4WBP3; TBX1 |
Summary | Plays a role in endosomal protein trafficking and in targeting proteins for lysosomal degradation. Plays a role in targeting endocytosed EGFR and ERGG3 for lysosomal degradation, and thereby helps downregulate downstream signaling cascades (PubMed:23166352). Helps recruit the ESCRT complex components TSG101, HGS and STAM to cytoplasmic membranes. Probably plays a role in regulating protein degradation via its interaction with NEDD4 (By similarity). May also contribute to the regulation of gene expression in the nucleus. Binds DNA (in vitro) and may play a synergistic role with STAT6 in the nucleus in regulating the expression of various cytokines (PubMed:15793005, PubMed:21980379). May regulate the expression of numerous cytokines, such as TNF, CCL2, CCL5, CXCL1, IL1A and IL10 (PubMed:12355436, PubMed:15025820, PubMed:16954198, PubMed:21980379, PubMed:22160695).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
You may also need
Customer
Reviews
Loading...