Hscb (NM_153571) Mouse Recombinant Protein
CAT#: TP501219
Purified recombinant protein of Mouse HscB iron-sulfur cluster co-chaperone (Hscb), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
货期*
4周
规格
Product images
推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR201219 protein sequence
Red=Cloning site Green=Tags(s) MNCNRSFRVDVTKLQHRYQQLQRLVHPDFFSQKSQTEKHFSDKHSTLVNDAYKTLQAPLTRGLYLLKLQG IEIPEGTDYKADSQFLVEIMEINERLADAQSEAAMEEIEATVRAKQKEFTDNINSAFEQGDFEKAKELLT KMRYFSNIEEKIKLSKTPL myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 18.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_705799 |
| Locus ID | 100900 |
| UniProt ID | Q8K3A0 |
| Refseq Size | 825 |
| Cytogenetics | 5 F |
| Refseq ORF | 477 |
| Synonyms | AI325508; AW049829; Hsc20 |
| Summary | Acts as a co-chaperone in iron-sulfur cluster assembly in both mitochondria and the cytoplasm. Required for incorporation of iron-sulfur clusters into SDHB, the iron-sulfur protein subunit of succinate dehydrogenase that is involved in complex II of the mitochondrial electron transport chain. Recruited to SDHB by interaction with SDHAF1 which first binds SDHB and then recruits the iron-sulfur transfer complex formed by HSC20, HSPA9 and ISCU through direct binding to HSC20. Also mediates complex formation between components of the cytosolic iron-sulfur biogenesis pathway and the CIA targeting complex composed of CIAO1, DIPK1B/FAM69B and MMS19 by binding directly to the scaffold protein ISCU and to CIAO1. This facilitates iron-sulfur cluster insertion into a number of cytoplasmic and nuclear proteins including POLD1, ELP3, DPYD and PPAT.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
You may also need
Customer
Reviews
Loading...
