Fam162a (NM_027342) Mouse Recombinant Protein
CAT#: TP501149
Purified recombinant protein of Mouse family with sequence similarity 162, member A (Fam162a), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR201149 protein sequence
Red=Cloning site Green=Tags(s) MWSLGGLRLAAGHCLRLYERNASSSLRFTRNTDLKRINGFCTKPQESPKTPTQSYRHGVPLHKPTDFEKK ILLWSGRFKKEEEIPETISFEMLDAAKNKLRVKVSYLMIALTVAGCIYMVIEGKKAAKRHESLTSLNLER KARLREEAAMKAKTD myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 17.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_081618 |
| Locus ID | 70186 |
| UniProt ID | Q9D6U8 |
| Refseq Size | 635 |
| Cytogenetics | 16 B3 |
| Refseq ORF | 465 |
| Synonyms | 2310056P07Rik; HGTD-P |
| Summary | Proposed to be involved in regulation of apoptosis; the exact mechanism may differ between cell types/tissues. May be involved in hypoxia-induced cell death of transformed cells implicating cytochrome C release and caspase activation (such as CASP9) and inducing mitochondrial permeability transition. May be involved in hypoxia-induced cell death of neuronal cells probably by promoting release of AIFM1 from mitochondria to cytoplasm and its translocation to the nucleus; however, the involvement of caspases has been reported conflictingly.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
其它Fam162a产品
