Ripply3 (NM_133229) Mouse Recombinant Protein
CAT#: TP501099
Purified recombinant protein of Mouse ripply transcriptional repressor 3 (Ripply3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR201099 representing NM_133229
Red=Cloning site Green=Tags(s) MRPEAAGVREARGRLCHCPGDDPGRLPLPRGPESSIPAPWRPWMSPPPGDAELTRTERPCESWGDQHTSG SKGAFGFQHPVRLYLPVSKRQEYLQSSGEKVLASFPVQATIHFYNDDSESGSEEEQEEEAQPNHLQCLEA EVRDSAQEERAE myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 17 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_573492 |
| Locus ID | 170765 |
| UniProt ID | Q924S9 |
| Refseq Size | 1554 |
| Cytogenetics | 16 C4 |
| Refseq ORF | 456 |
| Synonyms | Dscr6 |
| Summary | Acts as a transcriptional corepressor. Negative regulator of the transcriptional activity of TBX1. Plays a role in the development of the pharyngeal apparatus and derivatives.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
其它Ripply3产品
