1500015O10Rik (NM_024283) Mouse Recombinant Protein
CAT#: TP501031
Purified recombinant protein of Mouse RIKEN cDNA 1500015O10 gene (1500015O10Rik), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR201031 representing NM_024283
Red=Cloning site Green=Tags(s) MSTSSARPAVLALAGLALLLLLCLGPDGISGNKLKKMLQKREGPVPSKTNVAVAENTAKEFLGGLKRAKR QLWDRTRPEVQQWYQQFLYMGFDEAKFEDDVNYWLNRNRNGHDYYGDYYQRHYDEDAAIGPHSRESFRHG ASVNYDDY myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 17.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_077245 |
| Locus ID | 78896 |
| UniProt ID | Q99LS0 |
| Refseq Size | 867 |
| Cytogenetics | 1 C1.1 |
| Refseq ORF | 444 |
| Synonyms | Ecrg4 |
| Summary | Probable hormone that may attenuate cell proliferation and induce senescence of oligodendrocyte and neural precursor cells in the central nervous system (PubMed:20404145). ECRG4-induced senescence is characterized by G1 arrest, RB1 dephosphorylation and accelerated CCND1 and CCND3 proteasomal degradation (PubMed:20404145).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
其它1500015O10Rik产品
