Dnajc24 (NM_026992) Mouse Recombinant Protein
CAT#: TP501010
Purified recombinant protein of Mouse DnaJ heat shock protein family (Hsp40) member C24 (Dnajc24), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images

CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR201010 protein sequence
Red=Cloning site Green=Tags(s) MALEQTLKKDWYSILGADPSANMSDLKQKYQKLILLYHPDKQSADVPAGTMEECMQKFIEIDQAWKILGN EETKKKYDLQRHEDELRNVGPVDAQVRLEEMSWNQGDESFFLSCRCGGKYTVSKDEAQEATLISCDACSL IVELLHQS SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-MYC/DDK |
Predicted MW | 16.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_081268 |
Locus ID | 99349 |
UniProt ID | Q91ZF0 |
Refseq Size | 1198 |
Cytogenetics | 2 E3 |
Refseq ORF | 444 |
Synonyms | 1700030A21Rik; 2610027M02Rik; AV066965; AW240712; Dph4; MmDjC7; Zcsl3 |
Summary | The iron-bound form is redox-active and can function as electron carrier (By similarity). Stimulates the ATPase activity of several Hsp70-type chaperones. This ability is enhanced by iron-binding. Plays a role in the diphthamide biosynthesis, a post-translational modification of histidine which occurs in translation elongation factor 2 (EEF2).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
其它Dnajc24产品