Hba-a1 (NM_008218) Mouse Recombinant Protein
CAT#: TP500921
Purified recombinant protein of Mouse hemoglobin alpha, adult chain 1 (Hba-a1), full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
View other "Hba-a1" proteins (2)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR200921 representing NM_008218
Red=Cloning site Green=Tags(s) MVLSGEDKSNIKAAWGKIGGHGAEYGAEALERMFASFPTTKTYFPHFDVSHGSAQVKGHGKKVADALANA AGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPADFTPAVHASLDKFLASVSTVLTSK YR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 15.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for at least 3 months from receipt of products under proper storage and handling conditions. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_032244 |
| Locus ID | 15122 |
| UniProt ID | Q91VB8 |
| Refseq Size | 569 |
| Cytogenetics | 11 18.86 cM |
| Refseq ORF | 426 |
| Synonyms | Hba; Hba1; Hbat1 |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
