Brms1 (BC003485) Mouse Recombinant Protein
CAT#: TP500909
Purified recombinant protein of Mouse breast cancer metastasis-suppressor 1 (cDNA clone MGC:6927 IMAGE:2811430), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR200909 protein sequence
Red=Cloning site Green=Tags(s) MPIQPSGKETEEMEAEGDSAAEMNGEADESEEERSGSQTESEEESSEMDDEDYERRRSECVSEMLDLEKQ FSELKEKLFRERLSQLRLRLEEVGAERAPEYTEPLGGLQQSLKIRIQVAGIYKGFCLDVIRNKYECELQG G myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 16.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| Locus ID | 107392 |
| UniProt ID | Q99N20 |
| Refseq Size | 1212 |
| Cytogenetics | 19 A |
| Refseq ORF | 423 |
| Synonyms | AV003220; AW554636 |
| Summary | Transcriptional repressor. Down-regulates transcription activation by NF-kappa-B by promoting the deacetylation of RELA at 'Lys-310'. Promotes HDAC1 binding to promoter regions. Down-regulates expression of anti-apoptotic genes that are controlled by NF-kappa-B. Promotes apoptosis in cells that have inadequate adherence to a substrate, a process called anoikis, and may thereby inhibit metastasis (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
