Fabp2 (NM_007980) Mouse Recombinant Protein

CAT#: TP500767

Purified recombinant protein of Mouse fatty acid binding protein 2, intestinal (Fabp2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR200767 protein sequence
Red=Cloning site Green=Tags(s)

MAFDGTWKVDRNENYEKFMEKMGINVMKRKLGAHDNLKLTITQDGNKFTVKESSNFRNIDVVFELGVNFP
YSLADGTELTGAWTIEGNKLIGKFTRVDNGKELIAVREVSGNELIQTYTYEGVEAKRFFKKE

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 15.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_032006
Locus ID 14079
UniProt ID P55050
Refseq Size 977
Cytogenetics 3 53.74 cM
Refseq ORF 396
Synonyms Fa; Fabpi; I-F; I-FABP
Summary The protein encoded by this gene is part of the fatty acid binding protein family (FABP). FABPs are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands and participate in fatty acid uptake, transport, and metabolism. This protein functions within enterocytes, possibly to sense lipids as part of energy homeostasis. In humans polymorphisms are associated with increased fat oxidation and insulin resistance. In mice deficiency of this gene alters body weight in a gender-specific manner and causes hyperinsulinemia. [provided by RefSeq, Jan 2013]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...