Polr2f (NM_027231) Mouse Recombinant Protein
CAT#: TP500686
Purified recombinant protein of Mouse polymerase (RNA) II (DNA directed) polypeptide F (Polr2f), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
货期*
4周
规格
Product images
推荐一起购买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR200686 protein sequence
Red=Cloning site Green=Tags(s) MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRA LQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELIISD myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 14.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_081507 |
| Locus ID | 69833 |
| UniProt ID | P61219 |
| Refseq Size | 612 |
| Cytogenetics | 15 37.7 cM |
| Refseq ORF | 381 |
| Synonyms | 1810060D16Rik; RPB6 |
| Summary | DNA-dependent RNA polymerases catalyze the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and small RNAs, such as 5S rRNA and tRNAs, respectively. Pol II is the central component of the basal RNA polymerase II transcription machinery. Pols are composed of mobile elements that move relative to each other. In Pol II, POLR2F/RPB6 is part of the clamp element and together with parts of RPB1 and RPB2 forms a pocket to which the RPB4-RPB7 subcomplex binds (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
You may also need
Customer
Reviews
Loading...
