Lsm10 (NM_001163266) Mouse Recombinant Protein

CAT#: TP500601

Purified recombinant protein of Mouse U7 snRNP-specific Sm-like protein LSM10 (Lsm10), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR200601 protein sequence
Red=Cloning site Green=Tags(s)

MALSHSVKERTISENSLIILLQGLQGQITTVDLRDESVARGRIDNVDAFMNIRLANVTYTDRWGHQVELD
DLFVTGRNVRYVHIPDGVDITATIEQQLQIIHRVRNFGGKGQGRREFPSKRP

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 13.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001156738
Locus ID 116748
UniProt ID Q8QZX5
Refseq Size 825
Cytogenetics 4 D2.2
Refseq ORF 366
Summary Appears to function in the U7 snRNP complex that is involved in histone 3'-end processing (By similarity). Increases U7 snRNA levels but not histone 3'-end pre-mRNA processing activity, when overexpressed (By similarity). Required for cell cycle progression from G1 to S phases (By similarity). Binds specifically to U7 snRNA (By similarity). Binds specifically to U7 snRNA (By similarity). Binds to the downstream cleavage product (DCP) of histone pre-mRNA.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...