Atp6v1g1 (NM_024173) Mouse Recombinant Protein
CAT#: TP500546
Purified recombinant protein of Mouse ATPase, H+ transporting, lysosomal V1 subunit G1 (Atp6v1g1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images

CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR200546 protein sequence
Red=Cloning site Green=Tags(s) MASQSQGIQQLLQAEKRAAEKVSEARKRKNRRLKQAKEEAQAEIEQYRLQREKEFKAKEAAALGSHGSCS SEVEKETREKMTVLQNYFEQNRDEVLDNLLAFVCDIRPEIHENYRING myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 13.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_077135 |
Locus ID | 66290 |
UniProt ID | Q9CR51 |
Refseq Size | 1109 |
Cytogenetics | 4 B3 |
Refseq ORF | 354 |
Synonyms | 1810024D14Rik; AA960677; Atp6g1; ATP6J; VAG1; Vma10 |
Summary | Catalytic subunit of the peripheral V1 complex of vacuolar ATPase (V-ATPase). V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. In aerobic conditions, involved in intracellular iron homeostasis, thus triggering the activity of Fe(2+) prolyl hydroxylase (PHD) enzymes, and leading to HIF1A hydroxylation and subsequent proteasomal degradation (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
其它Atp6v1g1产品