5330431N19Rik (BC027559) Mouse Recombinant Protein
CAT#: TP500449
Purified recombinant protein of Mouse RIKEN cDNA 5330431N19 gene (cDNA clone MGC:41405 IMAGE:1493971), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images

CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR200449 protein sequence
Red=Cloning site Green=Tags(s) MAVTSWLEVLRSAEKTALLQDGKRMVHYLFPDGKEMAEEYDEKTSELLVRKWRVKNALGALGQWQLEVGE PVPSGAGSLGSELIKETHLHAQGHQNKFPVADSKSPLPEGCV myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 12.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
Locus ID | 226162 |
UniProt ID | Q8BPA8 |
Refseq Size | 850 |
Cytogenetics | 19 C3 |
Refseq ORF | 336 |
Synonyms | 5330431N19Rik; Ndac |
Summary | May play a role in the formation or function of ciliated cells.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
其它5330431N19Rik产品