Pf4 (NM_019932) Mouse Recombinant Protein
CAT#: TP500359
Purified recombinant protein of Mouse platelet factor 4 (Pf4), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 2900.00
| Cited in 1 publication. | 
Product images
                    
                CNY 600.00
Specifications
| Product Data | |
| Species | Mouse | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >MR200359 representing NM_019932 
Red=Cloning site Green=Tags(s) MSVAAVFRGLRPSPELLLLGLLFLPAVVAVTSAGPEESDGDLSCVCVKTISSGIHLKHITSLEVIKAGRH CAVPQLIATLKNGRKICLDRQAPLYKKVIEKILES myc-FLAG tag  | 
        
| Tag | C-MYC/DDK | 
| Predicted MW | 11.7 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C after receiving vials. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_064316 | 
| Locus ID | 56744 | 
| UniProt ID | Q9Z126 | 
| Refseq Size | 525 | 
| Cytogenetics | 5 E1 | 
| Refseq ORF | 315 | 
| Synonyms | Cxcl4; Scyb4 | 
| Summary | Released during platelet aggregation. Neutralizes the anticoagulant effect of heparin because it binds more strongly to heparin than to the chondroitin-4-sulfate chains of the carrier molecule. Chemotactic for neutrophils and monocytes. Inhibits endothelial cell proliferation (By similarity).[UniProtKB/Swiss-Prot Function] | 
Citations (1)
| The use of this Proteins has been cited in the following citations: | 
|---|
| 
                                                Critical role of CXCL4 in the lung pathogenesis of influenza (H1N1) respiratory infection.
                                                ,null,
                                                Mucosal immunology
                                                ,PubMed ID 28120850
                                                [Pf4]
                                                 | 
                                        
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| TP723860 | Purified recombinant protein of Mouse platelet factor 4 (Pf4 / PF-4) | 
                                                     CNY 4090.00  | 
                                            
