Pcbd1 (NM_025273) Mouse Recombinant Protein
CAT#: TP500344
Purified recombinant protein of Mouse pterin 4 alpha carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 1 (Pcbd1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images

CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR200344 protein sequence
Red=Cloning site Green=Tags(s) MAGKAHRLSAEERDQLLPNLRAVGWNEVEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVY NKVHITLSTHECAGLSERDINLASFIEQVAVSMT myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 12 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_079549 |
Locus ID | 13180 |
UniProt ID | P61458 |
Refseq Size | 822 |
Cytogenetics | 10 32.14 cM |
Refseq ORF | 312 |
Synonyms | Dcoh; Pcbd; Pcd; Phs |
Summary | This gene encodes a member of the pterin-4-alpha-carbinolamine dehydratase family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. The encoded protein functions as both a dehydratase involved in tetrahydrobiopterin biosynthesis, and as a cofactor for HNF1A-dependent transcription. [provided by RefSeq, Apr 2015] |
Documents
FAQs |
SDS |