1500034J01Rik (BC093523) Mouse Recombinant Protein
CAT#: TP500329
Purified recombinant protein of Mouse RIKEN cDNA 1500034J01 gene (cDNA clone MGC:103301 IMAGE:3711509), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR200329 protein sequence
Red=Cloning site Green=Tags(s) MADFLKGLPVYNKSNFSRFHADSVCKASNRRPSVYLPTREYPSEQIIVTEKTNILLRYLHQQWDKKNAAK KRDQEQVEAEGESSAPPRKVARTDSPDMPEDT myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 11.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| Locus ID | 66498 |
| UniProt ID | Q9D9Z5 |
| Refseq Size | 1897 |
| Cytogenetics | 8 B3.3 |
| Refseq ORF | 306 |
| Synonyms | 1500034J01Rik; 1700095J19Rik; R74921 |
| Summary | May be involved in ubiquitination and subsequent proteasomal degradation of target proteins. Component of the DDD-E2 complexes which may provide a platform for interaction with CUL4A and WD repeat proteins (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
其它1500034J01Rik产品
