Eif4ebp3 (NM_201256) Mouse Recombinant Protein
CAT#: TP500316
Purified recombinant protein of Mouse eukaryotic translation initiation factor 4E binding protein 3 (Eif4ebp3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR200316 representing NM_201256
Red=Cloning site Green=Tags(s) MSSSTSCPIPGCRDQLPDGYSTTPGGTLYATTPGGTRIIYDRKFLLECKNSPIARTPPCCLPQIPGVTTL PAVPPSKLELLKEQKQTEVEITDDEQFEMDM myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 11.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_957708 |
| Locus ID | 108112 |
| UniProt ID | Q80VV3 |
| Refseq Size | 1151 |
| Cytogenetics | 18 B2 |
| Refseq ORF | 303 |
| Synonyms | 4e-bp3 |
| Summary | Repressor of translation initiation that regulates EIF4E activity by preventing its assembly into the eIF4F complex: hypophosphorylated form competes with EIF4G1/EIF4G3 and strongly binds to EIF4E, leading to repress translation. In contrast, hyperphosphorylated form dissociates from EIF4E, allowing interaction between EIF4G1/EIF4G3 and EIF4E, leading to initiation of translation.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
其它Eif4ebp3产品
