Timm10b (NM_019502) Mouse Recombinant Protein
CAT#: TP500306
Purified recombinant protein of Mouse translocase of inner mitochondrial membrane 10B (Timm10b), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images

CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR200306 protein sequence
Red=Cloning site Green=Tags(s) MEQQQQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLMAAYVHLMPA LVQRRIADYEAASAAPGIPAEQTRDSPSGS myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 11.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_062375 |
Locus ID | 14356 |
UniProt ID | Q9WV96 |
Refseq Size | 1013 |
Cytogenetics | 7 E3 |
Refseq ORF | 300 |
Synonyms | Fxc1; Tim9b; Tim10b |
Summary | Component of the TIM22 complex, a complex that mediates the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. The TIM22 complex forms a twin-pore translocase that uses the membrane potential as the external driving force. In the TIM22 complex, it may act as a docking point for the soluble 70 kDa complex that guides the target proteins in transit through the aqueous mitochondrial intermembrane space.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
其它Timm10b产品