Dpy30 (NM_001146224) Mouse Recombinant Protein
CAT#: TP500297
Purified recombinant protein of Mouse dpy-30, histone methyltransferase complex regulatory subunit (Dpy30), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
货期*
4周
规格
Product images
推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR200297 protein sequence
Red=Cloning site Green=Tags(s) MESEQMLEGQTQVAENPHSEYGLTDSVERIVENEKINAEKSSKQKVDLQSLPTRAYLDQTVVPILLQGLA VLAKERPPNPIEFLASYLLKNKAQFEDRN myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 11.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001139696 |
| Locus ID | 66310 |
| UniProt ID | Q99LT0 |
| Refseq Size | 710 |
| Cytogenetics | 17 E2 |
| Refseq ORF | 297 |
| Synonyms | 2810410M20Rik; C87842 |
| Summary | As part of the MLL1/MLL complex, involved in the methylation of histone H3 at 'Lys-4', particularly trimethylation. Histone H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. May play some role in histone H3 acetylation. In embryonic stem (ES) cells, plays a crucial role in the differentiation potential, particularly along the neural lineage, regulating gene induction and histone H3 'Lys-4' methylation at key developmental loci, including that mediated by retinoic acid. Does not affect ES cell self-renewal. May also play an indirect or direct role in endosomal transport.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
You may also need
Customer
Reviews
Loading...
