Fxyd1 (NM_052991) Mouse Recombinant Protein
CAT#: TP500238
Purified recombinant protein of Mouse FXYD domain-containing ion transport regulator 1 (Fxyd1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
货期*
4周
规格
Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR200238 protein sequence
Red=Cloning site Green=Tags(s) MASPGHILALCVCLLSMASAEAPQEPDPFTYDYHTLRIGGLTIAGILFILGILIILSKRCRCKFNQQQRT GEPDEEEGTFRSSIRRLSSRRR myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 10.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_443717 |
Locus ID | 56188 |
UniProt ID | Q9Z239 |
Refseq Size | 558 |
Cytogenetics | 7 B1 |
Refseq ORF | 276 |
Synonyms | 0610012C17Rik; 1110006M24Rik; P; Plm; Pml |
Summary | This gene encodes a member of the FXYD family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The protein encoded by this gene is a plasma membrane substrate for several kinases, including protein kinase A, protein kinase C, NIMA kinase, and myotonic dystrophy kinase. It is thought to form an ion channel or regulate ion channel activity and act as an accessory protein of Na,K-ATPase. Alternatively spliced transcript variants have been described. [provided by RefSeq, Sep 2009] |
Documents
FAQs |
SDS |
You may also need
Customer
Reviews
Loading...