Hbxip (BC028547) Mouse Recombinant Protein
CAT#: TP500230
Purified recombinant protein of Mouse hepatitis B virus x interacting protein (cDNA clone MGC:41446 IMAGE:1513442), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR200230 protein sequence
Red=Cloning site Green=Tags(s) MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAARLTSDPTDIPVVCLESD NGNIMIQKHDGITVAVHKMAS myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 9.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| Locus ID | 68576 |
| UniProt ID | Q9D1L9 |
| Refseq Size | 735 |
| Cytogenetics | 3 F2.3 |
| Refseq ORF | 273 |
| Synonyms | 1110003H18Rik; Hbxip; XIP |
| Summary | As part of the Ragulator complex it is involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. Activated by amino acids through a mechanism involving the lysosomal V-ATPase, the Ragulator functions as a guanine nucleotide exchange factor activating the small GTPases Rag. Activated Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated. When complexed to BIRC5, interferes with apoptosome assembly, preventing recruitment of pro-caspase-9 to oligomerized APAF1, thereby selectively suppressing apoptosis initiated via the mitochondrial/cytochrome c pathway (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
