Dph3 (BC029910) Mouse Recombinant Protein
CAT#: TP500155
Purified recombinant protein of Mouse DPH3 homolog (KTI11, S. cerevisiae) (cDNA clone MGC:36233 IMAGE:4920779), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images

CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR200155 protein sequence
Red=Cloning site Green=Tags(s) MAVFHDEVEIEDFQYDEDSETYFYPCPCGDNFAITKEDLENGEDVATCPSCSLIIKVIYDKDQFMCGETV PAPSTNKELVKC myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 9.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
Locus ID | 105638 |
UniProt ID | Q8K0W9 |
Refseq Size | 677 |
Cytogenetics | 14 B |
Refseq ORF | 246 |
Synonyms | DelgipP1, Desr1, DELGIP1 |
Summary | Essential for the first step in the synthesis of diphthamide, a post-translational modification of histidine which occurs in elongation factor 2.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |