Ctnnbip1 (NM_001141930) Mouse Recombinant Protein
CAT#: TP500147
Purified recombinant protein of Mouse catenin beta interacting protein 1 (Ctnnbip1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR200147 representing NM_001141930
Red=Cloning site Green=Tags(s) MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVSSQLSQLPQHSIDQGAEDVVMA FSRSETEDRRQ myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 9.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001135402 |
| Locus ID | 67087 |
| UniProt ID | Q9JJN6 |
| Refseq Size | 2580 |
| Cytogenetics | 4 E2 |
| Refseq ORF | 243 |
| Synonyms | 1110008O09Rik; 2310001I19Rik; AW457332; Catnbip1; Icat |
| Summary | Prevents the interaction between CTNNB1 and TCF family members, and acts as negative regulator of the Wnt signaling pathway.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
其它Ctnnbip1产品
