Hopx (NM_001159901) Mouse Recombinant Protein

CAT#: TP500084

Purified recombinant protein of Mouse HOP homeobox (Hopx), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR200084 protein sequence
Red=Cloning site Green=Tags(s)

MSAQTASGPTEDQVEILEYNFNKVNKHPDPTTLCLIAAEAGLTEEQTQKWFKQRLAEWRRSEGLPSECRS
VTD

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 8.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001153373
Locus ID 74318
UniProt ID Q8R1H0
Refseq Size 1233
Cytogenetics 5 C3.3
Refseq ORF 219
Synonyms 1110018K11Rik; 1200015P04Rik; 2300002F06Rik; AI848177; AW490897; Cameo; Hdop; Hod; Hop
Summary Atypical homeodomain protein which does not bind DNA and is required to modulate cardiac growth and development. Acts via its interaction with SRF, thereby modulating the expression of SRF-dependent cardiac-specific genes and cardiac development. Prevents SRF-dependent transcription either by inhibiting SRF binding to DNA or by recruiting histone deacetylase (HDAC) proteins that prevent transcription by SRF. Overexpression causes cardiac hypertrophy (PubMed:12297045, PubMed:12297046). Acts as a co-chaperone for HSPA1A and HSPA1B chaperone proteins and assists in chaperone-mediated protein refolding (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...