HYI (NM_001190880) Human Recombinant Protein
CAT#: TP331118
Recombinant protein of human hydroxypyruvate isomerase (putative) (HYI), transcript variant 3, 20 µg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC231118 representing NM_001190880
Red=Cloning site Green=Tags(s) MAPLRFSANLSWLFPELSGLPARVRAAGSSGFEAVEVAWPYAETPEALARAAREAGLRLVLINTPPGDQE KGEMGLGAVPGRQAAFREGLEQAVRYAKALGCPRIHLMAGRVPQGADRIAVKAEMEAVFLENLRHAAGVL AQEDLVGLLEPINTRITDPQYFLDTPQQAAAILQKVGRPNLQLQMDIFHWQIMDGNLTGNIREFLPIVGH VQVAQVPGRGEPSSPGELNFPYLFQLLEDEGYKGFVGCEYQPRGDTVEGLSWLRSYWDRRGHPEAGQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 30.9 |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001177809 |
| Locus ID | 81888 |
| UniProt ID | Q5T013 |
| Cytogenetics | 1p34.2 |
| Refseq ORF | 831 |
| Synonyms | HT036 |
| Summary | This gene encodes a putative hydroxypyruvate isomerase, which likely catalyzes the conversion of hydroxypyruvate to 2-hydroxy-3-oxopropanoate, and may be involved in carbohydrate transport and metabolism. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011] |
| Protein Pathways | Glyoxylate and dicarboxylate metabolism, Metabolic pathways |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410587 | HYI HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC434117 | HYI HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410587 | Transient overexpression lysate of hydroxypyruvate isomerase homolog (E. coli) (HYI) |
CNY 3080.00 |
|
| LY434117 | Transient overexpression lysate of hydroxypyruvate isomerase (putative) (HYI), transcript variant 3 |
CNY 3080.00 |
|
| PH302991 | HYI MS Standard C13 and N15-labeled recombinant protein (NP_112484) |
CNY 19520.00 |
|
| TP302991 | Recombinant protein of human hydroxypyruvate isomerase homolog (E. coli) (HYI), 20 µg |
CNY 2900.00 |
