PRSS55 (NM_001197020) Human Recombinant Protein
CAT#: TP331117
Recombinant protein of human protease, serine, 55 (PRSS55), transcript variant 2, 20 µg
View other "PRSS55" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC231117 representing NM_001197020
Red=Cloning site Green=Tags(s) MLLFSVLLLLSLVTGTQLGPRTPLPEAGVAILGRARGAHRPQPPHPPSPVSECGDRSIFEGRTRYSRITG GMEAEVGEFPWQVSIQARSEPFCGGSILNKWWILTAAHCLYSEELFPEELSVVLGTNDLTSPSMEIKEVA SIILHKDFKRANMDNDIALLLLASPIKLDDLKVPICLPTQPGPATWRECWVAGWGQTNAADKNSVKTDLM KAPMVIMDWEECSKMFPKLTKNMLCAGYKNESYDACKQSYFPTLQRMNTGSSQTKPPGSHTFHLQN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 31 |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001183949 |
Locus ID | 203074 |
UniProt ID | Q6UWB4 |
Cytogenetics | 8p23.1 |
Refseq ORF | 828 |
Synonyms | CT153; T-SP1; TSP1; UNQ9391 |
Summary | This gene encodes a member of a group of membrane-anchored chymotrypsin (S1)-like serine proteases. The enocoded protein is primarily expressed in the Leydig and Sertoli cells of the testis and may be involved in male fertility. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2010] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404946 | PRSS55 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC434116 | PRSS55 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404946 | Transient overexpression lysate of tryptophan/serine protease (T-SP1) |
CNY 3080.00 |
|
LY434116 | Transient overexpression lysate of protease, serine, 55 (PRSS55), transcript variant 2 |
CNY 3080.00 |