RNF135 (NM_001184992) Human Recombinant Protein
CAT#: TP329833
Recombinant protein of human ring finger protein 135 (RNF135), transcript variant 3, 20 µg
View other "RNF135" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC229833 representing NM_001184992
Red=Cloning site Green=Tags(s) MAGLGLGSAVPVWLAEDDLGCIICQGLLDWPATLPCGHSFCRHCLEALWGARDARRWACPTCRQGAAQQP HLRKNTLLQDLADKYRRAAREIQAGSDPAHCPCPGSSSLSSAAARPRRRPELQRVAVEKSITEVAQELTE LVEHLVDIVRSLQNQRPLSESGPDNELSILGKAFSSGVDLSMASPKLVTSDTAAGKIRDILHDLEEIQEK LQESVTWKEAPEAQMQGSLLPRLECSGTITAASISQAQENSWKPRLPPHAHCLTRATLHSGELLGLLSGP SIQPLT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 31.4 |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001171921 |
Locus ID | 84282 |
UniProt ID | Q8IUD6 |
Cytogenetics | 17q11.2 |
Refseq ORF | 858 |
Synonyms | L13; MMFD; REUL; Riplet |
Summary | The protein encoded by this gene contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. This gene is located in a chromosomal region known to be frequently deleted in patients with neurofibromatosis. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410198 | RNF135 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC432833 | RNF135 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410198 | Transient overexpression lysate of ring finger protein 135 (RNF135), transcript variant 1 |
CNY 4840.00 |
|
LY432833 | Transient overexpression lysate of ring finger protein 135 (RNF135), transcript variant 3 |
CNY 3080.00 |
|
PH319438 | RNF135 MS Standard C13 and N15-labeled recombinant protein (NP_115698) |
CNY 19520.00 |
|
TP319438 | Recombinant protein of human ring finger protein 135 (RNF135), transcript variant 1, 20 µg |
CNY 2900.00 |