Synaptotagmin 3 (SYT3) (NM_001160329) Human Recombinant Protein
CAT#: TP328970
Recombinant protein of human synaptotagmin III (SYT3), transcript variant 3, 20 µg
View other "Synaptotagmin 3" proteins (9)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC228970 protein sequence
Red=Cloning site Green=Tags(s) MSGDYEDDLCRRALILVSDLCARVRDADTNDRCQEFNDRIRGYPRGPDADISVSLLSVIVTFCGIVLLGV SLFVSWKLCWVHWRDKGGSAVGGGPLRKDLGPGVGLAGLVGGGGHHLAAGLGGHPLLGGPHHHAHAAHHP PFAELLEPGSLGGSDTPEPSYLDMDSYPEAAAAAVAAGVKPSQTSPELPSEGGAGSGLLLLPPSGGGLPS AQSHQQVTSLAPTTRYPALPRPLTQQTLTSQPDPSSEERPPALPLPLPGGEEKAKLIGQIKPELYQGTGP GGRRSGGGPGSGEAGTGAPCGRISFALRYLYGSDQLVVRILQALDLPAKDSNGFSDPYVKIYLLPDRKKK FQTKVHRKTLNPVFNETFQFSVPLAELAQRKLHFSVYDFDRFSRHDLIGQVVLDNLLELAEQPPDRPLWR DIVEGGSEKADLGELNFSLCYLPTAGRLTVTIIKASNLKAMDLTGFSDPYVKASLISEGRRLKKRKTSIK KNTLNPTYNEALVFDVAPESVENVGLSIAVVDYDCIGHNEVIGVCRVGPDAADPHGREHWAEMLANPRKP VEHWHQLVEEKTVTSFTKGSKGLSEKENSE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 63.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001153801 |
Locus ID | 84258 |
UniProt ID | Q9BQG1 |
Refseq Size | 2493 |
Cytogenetics | 19q13.33 |
Refseq ORF | 1770 |
Synonyms | SytIII |
Summary | Ca(2+) sensor involved in Ca(2+)-dependent exocytosis of secretory vesicles through Ca(2+) and phospholipid binding to the C2 domain. Ca(2+) induces binding of the C2-domains to phospholipid membranes and to assembled SNARE-complexes; both actions contribute to triggering exocytosis (By similarity). Plays a role in dendrite formation by melanocytes (PubMed:23999003).[UniProtKB/Swiss-Prot Function] |
Protein Families | Secreted Protein, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410240 | SYT3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431996 | SYT3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431997 | SYT3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410240 | Transient overexpression lysate of synaptotagmin III (SYT3), transcript variant 1 |
CNY 3080.00 |
|
LY431996 | Transient overexpression lysate of synaptotagmin III (SYT3), transcript variant 2 |
CNY 3080.00 |
|
LY431997 | Transient overexpression lysate of synaptotagmin III (SYT3), transcript variant 3 |
CNY 3080.00 |
|
PH305963 | SYT3 MS Standard C13 and N15-labeled recombinant protein (NP_115674) |
CNY 19520.00 |
|
TP305963 | Recombinant protein of human synaptotagmin III (SYT3), 20 µg |
CNY 2900.00 |
|
TP328969 | Recombinant protein of human synaptotagmin III (SYT3), transcript variant 2, 20 µg |
CNY 2900.00 |
其它Synaptotagmin 3产品