C21orf62 (NM_001162496) Human Recombinant Protein
CAT#: TP328767
Purified recombinant protein of Homo sapiens chromosome 21 open reading frame 62 (C21orf62), transcript variant 3, 20 µg
View other "C21orf62" proteins (9)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC228767 representing NM_001162496
Red=Cloning site Green=Tags(s) MAPPSRHCLLLISTLGVFALNCFTKGQKNSTLIFTRENTIRNCSCSADIRDCDYSLANLMCNCKTVLPLA VERTSYNGHLTIWFTDTSALGHLLNFTLVQDLKLSLCSTNTLPTEYLAICGLKRLRINMEAKHPFPEQSL LIHSGGDSDSREKPMWLHKGWQPCMYISFLDMALFNRDSALKSYSIENVTSIANNFPDFSYFRTFPMPSN KSYVVTFIY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 24.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001155968 |
| Locus ID | 56245 |
| UniProt ID | Q9NYP8 |
| Cytogenetics | 21q22.11 |
| Refseq ORF | 657 |
| Synonyms | B37; C21orf120; PRED81 |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412723 | C21orf62 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431794 | C21orf62 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431795 | C21orf62 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY412723 | Transient overexpression lysate of chromosome 21 open reading frame 62 (C21orf62), transcript variant 2 |
CNY 3080.00 |
|
| LY431794 | Transient overexpression lysate of chromosome 21 open reading frame 62 (C21orf62), transcript variant 1 |
CNY 3080.00 |
|
| LY431795 | Transient overexpression lysate of chromosome 21 open reading frame 62 (C21orf62), transcript variant 3 |
CNY 3080.00 |
|
| TP328766 | Purified recombinant protein of Homo sapiens chromosome 21 open reading frame 62 (C21orf62), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP760350 | Purified recombinant protein of Homo sapiens chromosome 21 open reading frame 62 (C21orf62), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
|
| TP760361 | Purified recombinant protein of Human amyloid beta (A4) precursor-like protein 1 (APLP1), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
其它C21orf62产品
