ABHD14B (NM_001146314) Human Recombinant Protein
CAT#: TP328763
Recombinant protein of human abhydrolase domain containing 14B (ABHD14B), transcript variant 2, 20 µg
View other "ABHD14B" proteins (6)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC228763 protein sequence
Red=Cloning site Green=Tags(s) MAASVEQREGTIQVQGQALFFREALPGSGQARFSVLLLHGIRFSSETWQNLGTLHRLAQAGYRAVAIDLP GLGHSKEAAAPAPIGELAPGSFLAAVVDALELGPPVVISPSLSGMYSLPFLTAPGSQLPGFVPVAPICTD KINAANYASVKTPALIVYGDQDPMGQTSFEHLKQLPNHRVLIMKGAGHPCYLDKPEEWHTGLLDFLQGLQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 22.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001139786 |
| Locus ID | 84836 |
| UniProt ID | Q96IU4 |
| Refseq Size | 2253 |
| Cytogenetics | 3p21.2 |
| Refseq ORF | 630 |
| Synonyms | CIB; HEL-S-299 |
| Summary | Has hydrolase activity towards p-nitrophenyl butyrate (in vitro). May activate transcription.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409958 | ABHD14B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431791 | ABHD14B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409958 | Transient overexpression lysate of abhydrolase domain containing 14B (ABHD14B), transcript variant 1 |
CNY 3080.00 |
|
| LY431791 | Transient overexpression lysate of abhydrolase domain containing 14B (ABHD14B), transcript variant 2 |
CNY 3080.00 |
|
| PH303520 | ABHD14B MS Standard C13 and N15-labeled recombinant protein (NP_116139) |
CNY 19520.00 |
|
| TP303520 | Recombinant protein of human abhydrolase domain containing 14B (ABHD14B), 20 µg |
CNY 2900.00 |
其它ABHD14B产品
