POU6F2 (NM_001166018) Human Recombinant Protein
CAT#: TP328521
Purified recombinant protein of Homo sapiens POU class 6 homeobox 2 (POU6F2), transcript variant 2, 20 µg
View other "POU6F2" proteins (6)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC228521 representing NM_001166018
Red=Cloning site Green=Tags(s) MSALLQDPMIAGQVSKPLLSVRSEMNAELRGEDKAATSDSELNEPLLAPVESNDSEDTPSKLFGARGNPA LSDPGTPDQHQASQTHPPFPVGPQPLLTAQQLASAVAGVMPGGPPALNQPILIPFNMAGQLGGQQGLVLT LPTANLTNIQGLVAAAAAGGIMTLPLQNLQATSSLNSQLQQLQLQLQQQQQQQQQQPPPSTNQHPQPAPQ APSQSQQQPLQPTPPQQPPPASQQPPAPTSQLQQAPQPQQHQPHSHSQNQNQPSPTQQSSSPPQKPSQSP GHGLPSPLTPPNPLQLVNNPLASQAAAAAAAMSSIASSQAFGNALSSLQGVTGQLVTNAQGQIIGTIPLM PNPGPSSQAASGTQGLQVQPITPQLLTNAQGQIIATVIGNQILPVINTQGITLSPIKPGQQLHQPSQTSV GQAASQGNLLHLAHSQASMSQSPVRQASSSSSSSSSSSALSVGQLVSNPQTAAGEVDGVNLEEIREFAKA FKIRRLSLGLTQTQVGQALSATEGPAYSQSAICRFEKLDITPKSAQKIKPVLERWMAEAEARHRAGMQNL TEFIGSEPSKKRKRRTSFTPQALEILNAHFEKNTHPSGQEMTEIAEKLNYDREVVRVWFCNKRQALKNTI KRLKQHEPATAVPLEPLTDSLEENS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 69.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001159490 |
| Locus ID | 11281 |
| UniProt ID | P78424 |
| Cytogenetics | 7p14.1 |
| Refseq ORF | 1965 |
| Synonyms | RPF-1; WT5; WTSL |
| Summary | This gene encodes a member of the POU protein family characterized by the presence of a bipartite DNA binding domain, consisting of a POU-specific domain and a homeodomain, separated by a variable polylinker. The DNA binding domain may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner. The POU family members are transcriptional regulators, many of which are known to control cell type-specific differentiation pathways. This gene is a tumor suppressor involved in Wilms tumor (WT) predisposition. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.[provided by RefSeq, Oct 2009] |
| Protein Families | Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416091 | POU6F2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC431549 | POU6F2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416091 | Transient overexpression lysate of POU class 6 homeobox 2 (POU6F2), transcript variant 1 |
CNY 4840.00 |
|
| LY431549 | Transient overexpression lysate of POU class 6 homeobox 2 (POU6F2), transcript variant 2 |
CNY 3080.00 |
|
| PH324192 | POU6F2 MS Standard C13 and N15-labeled recombinant protein (NP_009183) |
CNY 19520.00 |
|
| TP324192 | Recombinant protein of human POU class 6 homeobox 2 (POU6F2), 20 µg |
CNY 2900.00 |
