TICAM2 (TMED7-TICAM2) (NM_001164469) Human Recombinant Protein
CAT#: TP328121
Recombinant protein of human TMED7-TICAM2 readthrough (TMED7-TICAM2), transcript variant 2, 20 µg
View other "TICAM2" proteins (2)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC228121 representing NM_001164469
Red=Cloning site Green=Tags(s) MPRPGSAQRWAAVAGRWGCRLLALLLLVPGPGGASEITFELPDNAKQCFYEDIAQGTKCTLEFQVITGGH YDVDCRLEDPDGKVLYKEMKKQYDSFTFTASKNGTYKFCFSNEFSTFTHKTVYFDFQVGEDPPLFPSENR VSALTQMESACVSIHEALKSVIDYQTHFRLREAQGRSRAEDLNTRVAY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 21.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001157941 |
| Locus ID | 100302736 |
| UniProt ID | Q86XR7 |
| Cytogenetics | 5q22.3 |
| Refseq ORF | 564 |
| Synonyms | MyD88-4; TICAM-2; TICAM2; TIRAP3; TIRP; TRAM |
| Summary | This locus represents naturally occurring read-through transcription between the neighboring transmembrane emp24 protein transport domain containing 7 (TMED7) and toll-like receptor adaptor molecule 2 (TICAM2) genes. Alternative splicing results in multiple transcript variants, one of which encodes a fusion protein that shares sequence identity with the products of each individual gene. This fusion product functions to negatively regulate the adaptor MyD88-independent toll-like receptor 4 pathway. [provided by RefSeq, Nov 2010] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
